The Deep Stateexistsanditknowsallaboutaliensand UF Os U Sofficialclaims

Show Politics and Government Publications

Sat, December 7, 2024

[ Sat, Dec 07th 2024 ]: The Australian Financial Review

Acrazysixhoursin Seoulandthefragilityofdemocracy

[ Sat, Dec 07th 2024 ]: Sydney Morning Herald

Protestoutsideplacesofworshipcouldbebannedin NS Wafter Great Synagogueincident

[ Sat, Dec 07th 2024 ]: Wall Street Journal

Whatto Know Aboutthe Civil Warin Syria

[ Sat, Dec 07th 2024 ]: New Republic

Pete Hegseths Mom Desperately Triesto Take Back Her Own Words

[ Sat, Dec 07th 2024 ]: Associated Press

Clintonsurgevotersagitatedbytodayspoliticstoremaininvolvedinpublicservice

[ Sat, Dec 07th 2024 ]: thenightly

Peter Duttonlabelssynagogueattackterrorismpureandsimple

[ Sat, Dec 07th 2024 ]: Fort Worth Star-Telegram

A North Texanasspeaker Heresthe Texas House Republicancaucusspeakerpick

[ Sat, Dec 07th 2024 ]: justthenews

Pearl Harbor Dayprovestobeaunifyingdayamidbitterpolitics

[ Sat, Dec 07th 2024 ]: BBC

Nomore Mr Nice Guyfor Keir Starmer

[ Sat, Dec 07th 2024 ]: RealClearPolitics

Jeffrey Goldbergon Hegseth Borderline Irresponsib .. ody With An Alcohol Problem Can Suddenly Clean Up

[ Sat, Dec 07th 2024 ]: RealClearPolitics

David Brookson Hunter Biden Biden Pardon Democrac .. ractices And Norms That Work Get Slowly Abandoned

[ Sat, Dec 07th 2024 ]: Esquire

The Curious Alchemyof How We Handlethe News

[ Sat, Dec 07th 2024 ]: BBC

Oneshotdeadonelectiondayin Ghana

[ Sat, Dec 07th 2024 ]: USA Today

French President Macronrollsouttheredcarpetfor Trumpaheadof Notre Damereopening

[ Sat, Dec 07th 2024 ]: WLRN

Pam Bondisjourneyfromtraditionalrepublicantowarriorfor Trump

[ Sat, Dec 07th 2024 ]: NJ.com

What DOG Edude Vivek Ramaswamygotwrongabout Trumpsvictory Hint Itsalot

[ Sat, Dec 07th 2024 ]: Salon

Welcometothe New Dark Ages

[ Sat, Dec 07th 2024 ]: The New York Times

Musk Cost- Cutting Effort Is Being Guidedby Health Entrepreneur

[ Sat, Dec 07th 2024 ]: The Mirror

Keir Starmerneedstodeliverorthepopulistswillpounce

[ Sat, Dec 07th 2024 ]: Couriermail

Josh Frydenbergand Nova Peristell Prime Ministertostepupafter Synagoguefirebombing

[ Sat, Dec 07th 2024 ]: The Daily Signal

Politicsof Economic Redistribution RI P

[ Sat, Dec 07th 2024 ]: Seattle Times

Trumpsalliesgoglobal Make Argentina Great Again

[ Sat, Dec 07th 2024 ]: Sydney Morning Herald

Albanese Wongdefend Australiasstanceon Israelfollowingcriticismfrom Netanyahu

[ Sat, Dec 07th 2024 ]: The Age

Ivealwaysbeenateamplayer Ben Carrollonthe VC Eexamcrisisandwhatdriveshim

[ Sat, Dec 07th 2024 ]: MSN

Ocasio- Cortezlaunchesbidtolead Democratsonpowerful Housecommittee

[ Sat, Dec 07th 2024 ]: KGOU

Activistsworrythat Trumpwillbulldozetransrights. Hereshowtheyrepreparing

[ Sat, Dec 07th 2024 ]: KPBS

Muskand Ramaswamys DOG Eechoespastbudgetpromisesthatfacedbighurdles

[ Sat, Dec 07th 2024 ]: NBC News

Democratsand Republicansin Congressworriedthat Gabbardmightleakinformationto Syria

[ Sat, Dec 07th 2024 ]: Oneindia

Did You Miss VCK Aadhav Arjuns Speech In Vijays Presence Watch It Here

[ Sat, Dec 07th 2024 ]: MSN

Iranordersevacuationofitssoldiersandciviliansfrom Syria- NY T

[ Sat, Dec 07th 2024 ]: Deccan Herald

Educatedyouthmustengageinpoliticstodrivechange CM Atishi

[ Sat, Dec 07th 2024 ]: The Daily Telegraph

Labourtransportadvisersback Extinction Rebellionand 20mphzones

[ Sat, Dec 07th 2024 ]: The Independent

Trumpreturnstoworldstageashejoins Zelenskyand Prince Williamat Notre Damereopening Live

[ Sat, Dec 07th 2024 ]: CNN

Trumptoattend Notre Dame Cathedralreopeningin Parisandmeetwith President Macron

[ Sat, Dec 07th 2024 ]: Reuters

Germanfar-rightleaderis Chinese-speakingeconomistwithforeignpartner

[ Sat, Dec 07th 2024 ]: tbsnews

Indiastartsenmitywith Bangladeshmerelytokeepfriendshipwithoneleader BN Pleader Asaduzzaman

[ Sat, Dec 07th 2024 ]: Seattle Times

Why Seattleleadersarereactingto Trumpdifferentlythistime

[ Sat, Dec 07th 2024 ]: WBEZ

Asnext Trumppresidencylooms Chicagogroupsservingimmigrantsarebracingfortheunexpected

[ Sat, Dec 07th 2024 ]: Reuters

Mexicobudgetcutsleaveitpoorlyplacedtohandle Trumpdeportationssourcessay

[ Sat, Dec 07th 2024 ]: Sahara Reporters

EXCLUSIVE Conversion Units At Port- Harcourt Refi .. ne Jet Fuel Despite NNPC Ls 2.9billion For Repair

[ Sat, Dec 07th 2024 ]: Irish Examiner

Simon Harris Fine Gaelshouldnotbetakenforgrantedingovernmentformationtalks

[ Sat, Dec 07th 2024 ]: New York Post

Bidenadminbroughtunprecedentedclimatechangeprosec .. mugglinggreenhousegasesbytransportingrefrigerants

[ Sat, Dec 07th 2024 ]: Reuters

Germanfar-right Af Dleaderis Chinese-speakinglesbianeconomist

[ Sat, Dec 07th 2024 ]: MSN

Furtherandfaster Why Trumps NAS Apickissendingshockwavesthroughthespacecommunity

[ Sat, Dec 07th 2024 ]: Channel NewsAsia Singapore

Growingvotersexpectationsandpublicscrutinyhampering Singaporepoliticalpartiesrecruitmentefforts

[ Sat, Dec 07th 2024 ]: Daily Express

Laboursbadpoliticsispavingthewayfora Torycomeback

[ Sat, Dec 07th 2024 ]: Newsweek

Washingtons Gerontocracy Faces Its Curtain Call

[ Sat, Dec 07th 2024 ]: USA Today

Gettoknow Providence Journal State Housereporter Patrick Anderson

Vacationing with Children can be Easy!

Rental of high quality Baby Gear & Beach Equipment, Delivered to Wherever You Are!

[ Sat, Dec 07th 2024 ]: MSN

Trumpoffersapublicshowofsupportfor Hegsethandsayshebelieveshecanbeconfirmed

[ Sat, Dec 07th 2024 ]: Cowboy State Daily

Lummis Joins Elons DOGE Push In Herculean Effort To Cut Government Pork

[ Sat, Dec 07th 2024 ]: Business Insider

Elon Musksays DOG Ecangutthefederalgovernmentwitharecent Supreme Courtruling. Somelawyersdisagree.

[ Sat, Dec 07th 2024 ]: The Daily Star

Femaleyouthvoicesfrom Bangladeshat CO P 29

[ Sat, Dec 07th 2024 ]: Pew Research Center

Strikingfindingsfrom 2024

[ Sat, Dec 07th 2024 ]: justthenews

Congress Trumpplanlawenforcementreformin D Ctoendpoliticizationandtofightcrime

[ Sat, Dec 07th 2024 ]: Krone

Elon Muskbiggestpoliticaldonorin U Shistory

[ Sat, Dec 07th 2024 ]: MSN

Whendoes Trumptakeofficeandhowcoulditimpactapotential Tik Tokban

[ Sat, Dec 07th 2024 ]: MSN

Russias LGBT Qcommunityislivinginfearfollowingnewlawsandcourtrulingsactivistssay

[ Sat, Dec 07th 2024 ]: The Washington Post

Whydemocraciesfrom South Koreato Francetothe U. S.areincrisis

[ Sat, Dec 07th 2024 ]: Sydney Morning Herald

Thefriendshipbetween Australiaand Israelisonlifesupport. Thereisalotofblametogoaround

[ Sat, Dec 07th 2024 ]: MSN

Canadasnew Arcticstrategyincludesopeningconsulatesboostingpresence

[ Sat, Dec 07th 2024 ]: MSN

EJ Antonirespondsto Bidenlaborsecretary Sparemethecriticismandthepearlclutching

[ Sat, Dec 07th 2024 ]: MSN

NJ Senator-elect Andy Kimtalks Trump Bidenandfindingcommonground

[ Sat, Dec 07th 2024 ]: MSN

Trumptapsforcefulallyofhard-lineimmigrationpoliciestohead Customsand Border Protection

[ Sat, Dec 07th 2024 ]: The National

Labourslammedforvowtomeddlein Scottishpolitics

[ Sat, Dec 07th 2024 ]: WOSU Public Media

Ohio Stateresearcherandgraduatesueafterarrestduring Gazaconflictprotest

[ Sat, Dec 07th 2024 ]: Toronto Star

Trudeaugovernmentsnewgunmeasuresdrawmixedreactionaspartiesrememberthosekilledin Montrealmassacre

[ Sat, Dec 07th 2024 ]: World Socialist Web Site

Democratsand Republicansexpresssupportforunelecte .. llionairesplanstoslashgovernmentandsocialspending

[ Sat, Dec 07th 2024 ]: MSN

Melania Trumpreactsto Barronsviralfameandcreditshimfordadselectionsuccess

[ Sat, Dec 07th 2024 ]: MSN

Albaypolitics 2top Albaypoliticiansjoinforcesvs Salceda

[ Sat, Dec 07th 2024 ]: MSN

Keir Starmerhumiliatedasformer Labour M Pwarns P Mwillbeoustedandwontsurvive

[ Sat, Dec 07th 2024 ]: MSN

Factcheck Livingstandardspledge National Insuranceandplanecrashimage

[ Sat, Dec 07th 2024 ]: MSN

Republicansand Democratsfileseparatebillsthatwoul .. ate Tennesseesgrocerytaxfornextlegislativesession

[ Sat, Dec 07th 2024 ]: MSN

Should Iwearmy MAG Ahattowork Iworemyhattoalocaldinerandgotanicereactionfromacoupleofpatrons.

[ Sat, Dec 07th 2024 ]: MSN

Romaniascancelledpresidentialelectionandwhyitmatters

[ Sat, Dec 07th 2024 ]: MSN

Whatdoesthe Texas Housespeakerdoandwhyare Republicansfighting

[ Sat, Dec 07th 2024 ]: The Washington Post

The Senatehasashrinkingwindowtoprotectpressfreedom

[ Sat, Dec 07th 2024 ]: News Talk 650 CKOM

Jagmeet Singhon GS Tholiday U. S. A.tariffsandbordersecurity

[ Sat, Dec 07th 2024 ]: The New York Times

Trump Transition Updates As Jan.6 Criminal Cases Against Trump Fizzle Civil Cases Plod Ahead

Fri, December 6, 2024

[ Fri, Dec 06th 2024 ]: The New York Times

Trump Transition Live Updates Trump Defends Hegsethas Fantasticfor Defense Secretary

[ Fri, Dec 06th 2024 ]: Politico

Serbiaand Kosovos Trumpoptimism

[ Fri, Dec 06th 2024 ]: The New Zealand Herald

Governmentsurvivesunderscrutinybutcrisisinhealthbecomingundeniable- Thomas Coughlan

[ Fri, Dec 06th 2024 ]: The Daily Star

Govtmustimprovelawandorderfast

[ Fri, Dec 06th 2024 ]: KCBX

Outgoing SLO Vice Mayorreflectsonaccomplishmentsandchallenges

[ Fri, Dec 06th 2024 ]: The Highland County Press

Populistconservatismand Constitutionalorder

[ Fri, Dec 06th 2024 ]: Nairametrics

Moreloansmorepainsandtheseasonofdiscontent

[ Fri, Dec 06th 2024 ]: Derbyshire Times

NE Derbyshire District Councilsnew Derbyshire Ind .. tsaimtogetridofpartypoliticsandfocusoncommunities

[ Fri, Dec 06th 2024 ]: KVOA 4

Ciscomanijoins DOGE Caucustopromotegovernmentefficiencyandreducewaste

[ Fri, Dec 06th 2024 ]: WOSU Public Media

Ohio State Universitygraduateandresearcherarrestedduring Aprilprotestssueuniversity

[ Fri, Dec 06th 2024 ]: Government Executive

Whatdoesthe NAS Aadministratordo

[ Fri, Dec 06th 2024 ]: RealClearPolitics

Whatthe Trump Nominees Have Not Done-- And Will Not Do

[ Fri, Dec 06th 2024 ]: CBS News

U. S.governmenttoclose Dublinwomensprisonafteryearsofinmateabuse

[ Fri, Dec 06th 2024 ]: St. Louis Post-Dispatch

Prosecutorsearnthousandsin St. Louis Countyandthousandsmoreinmunicourtsidejobs

[ Fri, Dec 06th 2024 ]: deseret

Rep. Blake Mooreonnavigatingrazor-thinmajoritymarginsandunitingthe Republican Party

[ Fri, Dec 06th 2024 ]: NBC News

Elon Muskspentaquarter-billiondollarselecting Trumpincludingfinancingmysterious RBGPA C

Vacationing with Children can be Easy!

Rental of high quality Baby Gear & Beach Equipment, Delivered to Wherever You Are!

[ Fri, Dec 06th 2024 ]: Crain's Chicago Business

Trumps A Iandcryptoczarhas Chicagoties

[ Fri, Dec 06th 2024 ]: The New York Times

In Britain Starmer Is Tryingto Fight Populism Fromthe Lonely Center

[ Fri, Dec 06th 2024 ]: RealClearPolitics

Obama The Power Of Pluralism Can Break This Cycle Of Cynicism

[ Fri, Dec 06th 2024 ]: Business Standard

Muskfundedsuper PA Ccomparing Trumpspositiononabortionto Ruth Bader

[ Fri, Dec 06th 2024 ]: The New York Times

Trump Transition Live Updates Latest Picks Focuson Borderand Immigration

[ Fri, Dec 06th 2024 ]: MSN

BREAKING Tensionin Kanoasheavilyarmedsecuritypersonneltakeover Emir Sanusispalace

[ Fri, Dec 06th 2024 ]: The Independent

Starmerpledgesgoldeneraofbuildingashetakesaimatenvironmentalregulations

[ Fri, Dec 06th 2024 ]: CNN

DOG Emeet REG O.32yearsbefore Elon Musk Al Gorereinventedgovernment

[ Fri, Dec 06th 2024 ]: The Independent

Trumpappointspodcasteras A Iandcryptoczar Bidenconsideringblanketpardonsbeforetransition Live

[ Fri, Dec 06th 2024 ]: BBC

Starmerand Dominic Cummingsnowagreeononething-thecivilserviceisaproblem

[ Fri, Dec 06th 2024 ]: Orlando Sentinel

Commentary Americansshouldnttakethebaitandabandonprinciples

[ Fri, Dec 06th 2024 ]: News & Record

How--andwhen--willthe Greensboro City Councilfilltheseatofthelate Yvonne Johnson

[ Fri, Dec 06th 2024 ]: cnbctv18

Mygoalwasgovernmentformationnottobecome C Msays Devendra Fadnavis

[ Fri, Dec 06th 2024 ]: MSN

Bernie Sanders Says RFK Jr.s Comments On Food Ind .. ctly Correct But Health Views Extremely Dangerous

[ Fri, Dec 06th 2024 ]: Crain's Chicago Business

Durbinand Ramaswamytradebarbsoverfederalloanto Rivian

[ Fri, Dec 06th 2024 ]: The Raw Story

Crackedunderthepressure Alarmsoundedaspostalworkersuicidesquadruple

[ Fri, Dec 06th 2024 ]: MSN

Map Shows States Where Millions Could Lose Coverageif Trump Cuts Medicaid

[ Fri, Dec 06th 2024 ]: MSN

Theresarudeawakeninginstoreforthe DOG Ebros

[ Fri, Dec 06th 2024 ]: MSN

Kamala Harrismockedforcontinuingtoputondozensofaccents

[ Fri, Dec 06th 2024 ]: Slate

Heres Whats Been Going Onatthe Supreme Court While Weve All Been Distracted

[ Fri, Dec 06th 2024 ]: AOL

Francepoliticslive Emmanuel Macrontopicknew P Mincomingdaysafter Michel Barnierresigns

[ Fri, Dec 06th 2024 ]: USA Today

Theweekinpolitics Sen. Marsha Blackburnannounces DOG Elegislation

[ Fri, Dec 06th 2024 ]: McClatchyDC

Takingtheaxout Kentuckys Comerhuddleswith Elon Muskonshrinkinggovernment

[ Fri, Dec 06th 2024 ]: gloucestershirelive.co.uk

Haveyoursay As Starmerpromisesmorepoliceareyouscaredtowalkyourstreets Shareyourstorieswithus

[ Fri, Dec 06th 2024 ]: The Indianapolis Star

Indiana Gov.-elect Mike Braunnameshiscabinet

[ Fri, Dec 06th 2024 ]: The New York Times

Britains Starmer Is Tryingto Fight Populism Fromthe Lonely Center

[ Fri, Dec 06th 2024 ]: The Mirror

Vladthe Invaderisscentingtotalvictoryin Ukraineandwillcost U Kdear

[ Fri, Dec 06th 2024 ]: London Evening Standard

Donald Trumpally Elon Muskwarnedagainsttryingtobepoliticalpuppetmasterpicking U Spresidents

[ Fri, Dec 06th 2024 ]: USA Today

Sentencingin President-elect Trumpshushmoneycaseindefinitelypostponed The Excerpt

[ Fri, Dec 06th 2024 ]: Inside Higher Ed

House Republicans Aimto Pass Higher Ed Overhaul

[ Fri, Dec 06th 2024 ]: MSN

Mel Stridesaystriplelockisunsustainableandcannotlastforever

[ Fri, Dec 06th 2024 ]: The Daily Star

34yearsof Ershadsfall Bangladeshwithanotherchancefordemocracy

[ Fri, Dec 06th 2024 ]: ABC

Musk Ramaswamyeyeingfederalremoteworkpoliciestohelpslash 2 Tfrombudget

[ Fri, Dec 06th 2024 ]: MSN

DA Hike Tips- The Modigovernmentgaveabiggifttocen .. 18monthsof D Aarrearswillbeavailableinthebudget.

[ Fri, Dec 06th 2024 ]: Manx Radio

Health Ministerdefendsjoininggovernmentafterno-confidencevote

[ Fri, Dec 06th 2024 ]: CBS News

Seethelistof Trump Cabinetpicksandmore White Houseappointmentssofar

[ Fri, Dec 06th 2024 ]: Reuters

Pakistansjailedformer PM Imran Khanthreatenscivildisobediencemovement

[ Fri, Dec 06th 2024 ]: MSN

VIDEO Afghanistans Qoshtepa Canaland Water Securityin Central Asia

[ Fri, Dec 06th 2024 ]: MSN

Elon Muskwarns U Sgovernmentemployeesof BI Gchangesas Trump 2.0settotakeoffice

[ Fri, Dec 06th 2024 ]: MSN

Trumpselectsbordercommissionerand Chinaambassadorinflurryofselections

[ Fri, Dec 06th 2024 ]: MSN

Elon Muskshowsofffatherhoodwithson Lil Xonhisshouldersathistoricgovernmentmeeting

[ Fri, Dec 06th 2024 ]: MSN

Bidenisconsideringpreemptivepardonsforofficialsandalliesbefore Trumptakesoffice

[ Fri, Dec 06th 2024 ]: MSN

Newinformationinalawsuitfiledby Iowastopelectionofficialagainstthefederalgovernment

[ Fri, Dec 06th 2024 ]: MSN

Macronhitsoutatirresponsibleoppositionandanti- Republicanfrontafter French PM Barnierousted

[ Fri, Dec 06th 2024 ]: Sydney Morning Herald

Blandandfake Whytheelectoratehasgivenuplisteningtopoliticians

[ Fri, Dec 06th 2024 ]: dw

Whyaretensionsflaringbetween Indiaand Bangladesh

[ Fri, Dec 06th 2024 ]: KGOU

Trumpnominates Rodney Scotttolead Customsand Border Protection

[ Fri, Dec 06th 2024 ]: MSN

Ladka Bhau Eknath Shinde Is Maharashtra Deputy CM Journey Of A Rebel- Turned- Action Man

Vacationing with Children can be Easy!

Rental of high quality Baby Gear & Beach Equipment, Delivered to Wherever You Are!

[ Fri, Dec 06th 2024 ]: MSN

MSNB Cs Joe Scarboroughfiresbackatcriticsstilloutragedover Trumpmeeting

[ Fri, Dec 06th 2024 ]: MSN

Itsajoke Top Demslams Elonand Viveks DOG Easgovernmentcosplay

[ Fri, Dec 06th 2024 ]: MSN

Devendra Fadnavistakesoathas Maharashtra C Mforth .. time Eknath Shindeand Ajit Pawarsworninasdeputies

[ Fri, Dec 06th 2024 ]: Richmond

Morepersonneldecisionslieaheadin Richmondelectionsofficeboardchairsays

[ Fri, Dec 06th 2024 ]: rediff.com

What You Can Now Expect Every Election

[ Fri, Dec 06th 2024 ]: Sydney Morning Herald

Actofhate Albaneseand Duttoncondemnsynagoguefirebombing

Thu, December 5, 2024

[ Thu, Dec 05th 2024 ]: Sky

Barnierlatest Emmanuel Macrontoappointnewprimeministerincomingdaysaftergovernmentcollapses

[ Thu, Dec 05th 2024 ]: ABC

Whois Tulsi Gabbard Meet Trumpspickfordirectorofnationalintelligence

[ Thu, Dec 05th 2024 ]: The Washington Post

Frances Macronvowstostayinofficetillendoftermsayshellnameanewprimeministersoon

[ Thu, Dec 05th 2024 ]: CNN

Senatorsweigh Hegsethcandidacyas Muskand Ramaswamymaketheircaseon Capitol Hill

[ Thu, Dec 05th 2024 ]: RealClearPolitics

Democratic Party Monopolyonthe Black Vote Is Over

[ Thu, Dec 05th 2024 ]: thenightly

Australianelectionpoll Peter Duttonprimedtowinmajoritygovernmentin 2025election

[ Thu, Dec 05th 2024 ]: Detroit Free Press

Inreliablyblue Californiathisruralcountyflippedandvotedfor Trump. Hereswhy

[ Thu, Dec 05th 2024 ]: ITV

Macronaccusesrivalsofbringingdisorderandwillnamenewprimeministerincomingdays

[ Thu, Dec 05th 2024 ]: KUOW

Francestoppledgovernmentaddstothe European Unionsbiggerpoliticalproblems

[ Thu, Dec 05th 2024 ]: Texas Public Radio

San Antonio City Councilapproveshigherfinessterilizationauthorityforlooseanddangerousdogs

[ Thu, Dec 05th 2024 ]: The Washington Post

Pakistanicourtindictsformer Premier Imran Khanover May 2023attacksonmilitaryposts

[ Thu, Dec 05th 2024 ]: PBS

Musk Ramaswamymeetwithlawmakerstobuildsupportforslashinggovernmentprograms

[ Thu, Dec 05th 2024 ]: USA Today

Vivek Ramaswamyoncecalled Elon Muskacircusmonkey. Nowtheyre DOG Epartners

[ Thu, Dec 05th 2024 ]: Sydney Morning Herald

Whentrustgoesbusthowwebindduringacrisisandbreakintheaftermath

[ Thu, Dec 05th 2024 ]: The New York Times

Elonand Viveks DOGE Goesto Congress

[ Thu, Dec 05th 2024 ]: Fox News

Fox News Politics Defining DOG E

[ Thu, Dec 05th 2024 ]: The New York Times

Trump Picks Ex- Congressman Who Hawked Tax Creditsto Lead I. R. S.

[ Thu, Dec 05th 2024 ]: MSNBC

Russian T Vhostgleefullyclaims Trumps Cabinetwilldismantle Americareportsays

[ Thu, Dec 05th 2024 ]: The Washington Post

Elon Muskand Vivek Ramaswamyarebringing Trumps DOG Eto Capitol Hill

[ Thu, Dec 05th 2024 ]: The New Zealand Herald

Twobootcampteensaremissingas Oranga Tamarikiofficialsfrontonparticipantsdeath

[ Thu, Dec 05th 2024 ]: Sydney Morning Herald

Israelcondemns Australias U Nflipflopsaysitrewardsterrorism

[ Thu, Dec 05th 2024 ]: Business Standard

Willfulfilpromiseofhiking Ladki Bahinstipendto Rs 2100 Fadnavis

[ Thu, Dec 05th 2024 ]: MSNBC

Why Trumpsattempttodismissthe New Yorkhushmoneycasewarrantsattention

[ Thu, Dec 05th 2024 ]: Mother Jones

John Roberts Hasa Planto Deny Transgender Rights

[ Thu, Dec 05th 2024 ]: The Free Press Journal

Different Journeys Same Destination Devendra Fadn .. Ajit Pawar Unite As Maharashtras Leadership Trio

[ Thu, Dec 05th 2024 ]: The Morning Sun

Can Sir Keir Starmerstopdeliveringgrandspeechesonwhathewantstodoandjustgettowork

[ Thu, Dec 05th 2024 ]: MSN

Georgia Governmentusingexcessiveforceagainstprotesters

[ Thu, Dec 05th 2024 ]: MSN

Billseekstrailsandcabinsnotpickleballcourtsandhotelsfor Floridastateparks

[ Thu, Dec 05th 2024 ]: MSN

Editorial Countytaxandbudgetcompromiseheraldsanewerain Alleghenygovernment

[ Thu, Dec 05th 2024 ]: MSN

Macronblamescoalitionoftheirresponsibleforhistoricoustingof Frenchgovernment

[ Thu, Dec 05th 2024 ]: ABC

Bidenconsideringpreemptivepardonsforofficials Trumpmighttarget Source

[ Thu, Dec 05th 2024 ]: MSN

Trumphasshadowpicksfor Pentagonchiefif Pete Hegse .. opsout. Theformer Fox Newshostsayshewontbackdown.

[ Thu, Dec 05th 2024 ]: MSN

South Boston Democratblocks Mayor Michelle Wustaxshiftbillin Senateforsecondtime

[ Thu, Dec 05th 2024 ]: Mother Jones

Avian Flu Could Define Trumps Second Presidency

[ Thu, Dec 05th 2024 ]: MSN

Trumpstillbacks Hegsethasnominationdoubtsremain M .. kand Ramaswamytalk DOG Eplanson Capitol Hill Live

[ Thu, Dec 05th 2024 ]: MSN

What Is Frances No- Confidence Voteand What Does It Meanforthe U S

[ Thu, Dec 05th 2024 ]: MSN

Whydid South Koreadeclaremartiallawandwhatisnextfor Yoon Suk Yeol

[ Thu, Dec 05th 2024 ]: MSN

Trudeauministersandoppositionleadersaddress AF Ngatheringin Ottawa

[ Thu, Dec 05th 2024 ]: MSN

Musk MT Gand Ramaswamytoset DOG Etargetsandgoals

[ Thu, Dec 05th 2024 ]: KGOU

Memphispoliceuseexcessiveforceanddiscriminateagainst Blackpeoplethe DO Jfinds

[ Thu, Dec 05th 2024 ]: MSN

Francepoliticslive Emmanuel Macrongivesspeechtonationafter French PM Barnierresigns

[ Thu, Dec 05th 2024 ]: MSN

FCI Dublinclosingpermanentlyafteryearsofabuseanddecay

Vacationing with Children can be Easy!

Rental of high quality Baby Gear & Beach Equipment, Delivered to Wherever You Are!

[ Thu, Dec 05th 2024 ]: Newsroom

Raw Politics Throwinginthetowelonclimateandtheforeshore

[ Thu, Dec 05th 2024 ]: Daily Record

Scottish Budget 2024 RECA Pas SNP Governmentconfirmsitwilllifttwo-childcap

[ Thu, Dec 05th 2024 ]: Sacramento Bee

Lt. Gov. Kounalakiswinsbidtoavoiddepositionin Fresno Stateretaliationlawsuit

[ Thu, Dec 05th 2024 ]: The Australian Financial Review

Howthe U Sand Chinaarepartneringreluctantlytosavetheworld

[ Thu, Dec 05th 2024 ]: MSN

Speaker Johnsonsayshedliketoaxe PB Sand Planned Parenthood

[ Thu, Dec 05th 2024 ]: Miami Herald

Ambitionsbillsandgrudges Reasons De Santisfordefensesecretarymayneverhappen

[ Thu, Dec 05th 2024 ]: MSN

Morning Joe Rips Criticsof Trump Meeting You Can Say He Had Fascist Rhetoricand Still Talkto Him

[ Thu, Dec 05th 2024 ]: MSN

The Tectonic Shift The Gaza Genocideandthe Limitsof Israeli Hasbara

[ Thu, Dec 05th 2024 ]: MSN

Ex-cardealerandincomingsenator Bernie Morenoslams E Vtaxcreditsascatastrophicallystupid

[ Thu, Dec 05th 2024 ]: CNAS

New CNAS Report Stress- Testing State Power When .. Presidents Divergeon Mattersof National Security

The Deep Stateexistsanditknowsallaboutaliensand UF Os U Sofficialclaims

//politics-government.news-articles.net/content/ .. wsallaboutaliensand-uf-os-u-sofficialclaims.html

Published in Politics and Government on Friday, December 6th 2024 at 12:02 GMT by MSN
^{🞛 This publication is a summary or evaluation of another publication 🞛 This publication contains editorial commentary or bias from the source}

There is a 'deep state' and the Pentagon could be hiding information about alien life and UFOs says one Government official, who spoke out about alien disclosure

Orbitz

The article discusses claims by Christopher Mellon, a former US Deputy Assistant Secretary of Defense for Intelligence, who asserts that a secretive group within the US government, often referred to as the "deep state," has been involved in the study of UFOs and extraterrestrial life for decades. Mellon, who has worked with the Senate Intelligence Committee, suggests that this group operates with significant autonomy, possibly even from the President, and has amassed a wealth of information on UFOs, including physical evidence like materials from crashed crafts. He believes that this secretive operation has been ongoing since at least the 1940s, with the government's interest in UFOs being driven by national security concerns. Mellon's revelations come at a time when there is increasing public and official interest in UFOs, highlighted by recent Congressional hearings and the establishment of the All-domain Anomaly Resolution Office (AARO) to investigate these phenomena.

Read the Full MSN Article at:
[ https://www.msn.com/en-gb/politics/government/the-deep-state-exists-and-it-knows-all-about-aliens-and-ufos-us-official-claims/ar-AA1voHfj ]

Vacationing with Children can be Easy!

Rental of high quality Baby Gear & Beach Equipment, Delivered to Wherever You Are!